1 7632A–MP3–03/06Features• Audio Processor– Proprietary Digital Signal Processor– MP3 (Full MPEG I/II-Layer 3) Decoder (1)– Windows Media® Audio (WMA
10AT85C51SND3Bx 7632A–MP3–03/06USB Controller Table 7. USB Controller Signal DescriptionNFCLE OCommand Latch Enable SignalAsserted high during comma
100AT85C51SND3Bx 7632A–MP3–03/06USB Software Operating modesDepending on the USB operating mode, the software should perform some of the follow-ing o
101 AT85C51SND3Bx7632A–MP3–03/06USB Device Operating modesIntroduction The USB device controller supports high speed and full speed data transfers. I
102AT85C51SND3Bx 7632A–MP3–03/06At the end of the reset process (Full or High), the end of reset interrupt (EORSTI) is gen-erated. Then the CPU shoul
103 AT85C51SND3Bx7632A–MP3–03/06– Clear DFCRDY to freeze the DFC transfer,– If the CPU EPNUM has to be changed: EPNUMS cleared, EPNUM = endpoint0– Re
104AT85C51SND3Bx 7632A–MP3–03/06• the host sends a SETUP command (SET_ADDRESS(addr)),• the firmware records that address in UADD, but keep ADDEN clea
105 AT85C51SND3Bx7632A–MP3–03/06Figure 61. Detach a device in Full-speed:Remote Wake-Up The “Remote Wake-up” (or “upstream resume”) request is the o
106AT85C51SND3Bx 7632A–MP3–03/06This function is compliant with the Chapter 8 test from PMTC that send extra status for a GET_DESCRIPTOR. The firmwar
107 AT85C51SND3Bx7632A–MP3–03/06Control Read The next figure shows a control read transaction. The USB controller has to manage the simultaneous writ
108AT85C51SND3Bx 7632A–MP3–03/06banks, clearing the FIFOCON bit will switch to the next bank. The RXOUTI and FIFO-CON bits are then updated by hardwa
109 AT85C51SND3Bx7632A–MP3–03/06• The CPU can read the data from the current bank (“N” read of UEDATX),• The CPU can free the bank by clearing FIFOCO
11 AT85C51SND3Bx7632A–MP3–03/06Audio Processor Table 8. I2S Output DescriptionTable 9. Audio Codec DescriptionUID IUSB OTG Identifier InputThis pin
110AT85C51SND3Bx 7632A–MP3–03/06writes into the FIFO and clears the FIFOCON bit to allow the USB controller to send the data. If the IN Endpoint is c
111 AT85C51SND3Bx7632A–MP3–03/06• The CPU can free the bank by clearing FIFOCON when all the data are written, that is:– after “N” write into UEDATX–
112AT85C51SND3Bx 7632A–MP3–03/06Table 111. Abort flowIsochronous Mode For Isochronous IN endpoints, it is possible to automatically switch the banks
113 AT85C51SND3Bx7632A–MP3–03/06Interrupts Figure 62 shows all the device interrupts sources while Figure 63 details the endpoint interrupt sources.F
114AT85C51SND3Bx 7632A–MP3–03/06Figure 63. USB Device Controller Endpoint Interrupt SystemProcessing interrupts are generated when the following eve
115 AT85C51SND3Bx7632A–MP3–03/06RegistersUSB Device General RegistersReset Value = 0000 0001bTable 112. UDCON RegisterUDCON (1.D9h) – USB Device Gen
116AT85C51SND3Bx 7632A–MP3–03/06Reset Value = 0000 0000b3 EORSTIEnd Of Reset Interrupt FlagSet by hardware when an “End Of Reset” has been detected b
117 AT85C51SND3Bx7632A–MP3–03/06Reset Value = 0000 0000bReset Value = 0000 0000bReset Value = 0000 0000b0 SUSPESuspend Interrupt Enable BitSet to ena
118AT85C51SND3Bx 7632A–MP3–03/06Reset Value = 0000 0000bReset Value = 0000 0000bUSB Device Endpoint RegistersReset Value = 0000 0000bBitNumberBitMnem
119 AT85C51SND3Bx7632A–MP3–03/06Reset Value = 0000 0000bReset Value = 0000 0000bBit NumberBit MnemonicDescription7 -ReservedThe value read from these
12AT85C51SND3Bx 7632A–MP3–03/06Parallel Slave Interface Table 10. PSI Signal DescriptionSerial Interfaces Table 11. SPI Controller Signal Descripti
120AT85C51SND3Bx 7632A–MP3–03/06Reset Value = 0000 0000bTable 122. UECFG0X RegisterUECFG0X (1.CCh) – USB Endpoint Configuration 1 Register7 6 5 4 3
121 AT85C51SND3Bx7632A–MP3–03/06Reset Value = 0000 0000b3-2 EPBK1:0Endpoint Bank BitsSet this field according to the endpoint size: 00b: Single bank
122AT85C51SND3Bx 7632A–MP3–03/06Reset Value = 0000 0000bReset Value = 0000 0000b1-0NBUSYBK1:0Busy Bank FlagSet by hardware to indicate the number of
123 AT85C51SND3Bx7632A–MP3–03/06Table 126. UEINTX Register (bit addressable)UEINTX (1.C8h) – USB Endpoint Interrupt Register7 6 5 4 3 2 1 0FIFOCON N
124AT85C51SND3Bx 7632A–MP3–03/06Reset Value = 0000 0000bReset Value = 0000 0000b1 STALLIStall Interrupt FlagSet by hardware to signal that a STALL ha
125 AT85C51SND3Bx7632A–MP3–03/06Reset Value = 0000 0000bReset Value = 0000 0000bReset Value = 0000 0000bTable 128. UEDATX RegisterUEDATX (1.D3h) – U
126AT85C51SND3Bx 7632A–MP3–03/06Reset Value = 0000 0000b.Table 131. UEINT RegisterUEINT (1.D6h) – USB Endpoint Interrupt Register7 6 5 4 3 2 1 0- EP
127 AT85C51SND3Bx7632A–MP3–03/06USB Host Operating ModesPipe Description For the USB Host controller, the term of Pipe is used instead of Endpoint fo
128AT85C51SND3Bx 7632A–MP3–03/06The Host controller enters in Suspend state when the USB bus is in Suspend state, i.e. when the Host controller doesn
129 AT85C51SND3Bx7632A–MP3–03/06Pipe Configuration The following flow must be respected in order to activate a Pipe:Figure 66. Pipe activation flow:
13 AT85C51SND3Bx7632A–MP3–03/06MMI Interface Table 13. Keypad Controller Signal DescriptionTable 14. LCD Interface Signal DescriptionPower Manageme
130AT85C51SND3Bx 7632A–MP3–03/06USB Reset The USB controller sends a USB Reset when the firmware set the RESET bit. The RSTI bit is set by hardware w
131 AT85C51SND3Bx7632A–MP3–03/06The firmware has to change the Token for each phase.The initial data toggle is set for the corresponding token (ONLY
132AT85C51SND3Bx 7632A–MP3–03/06“Manual” Mode The TXOUT bit is set by hardware when the current bank becomes free. This triggers an interrupt if the
133 AT85C51SND3Bx7632A–MP3–03/06“Autoswitch” Mode In this mode, the clear of the FIFOCON bit is performed automatically by hardware each time the Pip
134AT85C51SND3Bx 7632A–MP3–03/06“Autoswitch” Mode In this mode, the clear of the FIFOCON bit is performed automatically by hardware each time the Pip
135 AT85C51SND3Bx7632A–MP3–03/06Figure 68. USB Host Controller Pipe Interrupt SystemFLERREUPIENX.7TXOUTIUPINTX.2TXOUTEUPIENX.2TXSTPIUPINTX.3TXSTPEUP
136AT85C51SND3Bx 7632A–MP3–03/06RegistersGeneral USB Host RegistersReset Value = 0000 0000bTable 132. UHCON RegisterUHCON (1.D9h) – USB Host Genera
137 AT85C51SND3Bx7632A–MP3–03/06Reset Value = 0000 0000b4 RXRSMIUpstream Resume Received InterruptSet by hardware when an Upstream Resume has been re
138AT85C51SND3Bx 7632A–MP3–03/06Reset Value = 0000 0000bReset Value = 0000 0000bReset Value = 0000 0000b0 DCONNEDevice Connection Interrupt EnableSet
139 AT85C51SND3Bx7632A–MP3–03/06Reset Value = 0000 0000bReset Value = 0000 0000bUSB Host Pipe RegistersReset Value = 0000 0000bTable 137. UHFNUML R
14AT85C51SND3Bx 7632A–MP3–03/06OCD Interface Table 16. OCD Signal DescriptionBVSS GNDBattery GroundConnect this pin to the negative pin of the batte
140AT85C51SND3Bx 7632A–MP3–03/06Reset Value = 0000 0000bTable 140. UPRST RegisterUPRST (1.CAh) – USB Host Pipe Reset Register7 6 5 4 3 2 1 0- P6RST
141 AT85C51SND3Bx7632A–MP3–03/06Reset Value = 0000 0000bReset Value = 0000 0000b5 INMODEIN Request modeSet this bit to allow the USB controller to pe
142AT85C51SND3Bx 7632A–MP3–03/06Reset Value = 0000 0000bReset Value = 0000 0000bTable 143. UPCFG1X RegisterUPCFG1X (1.CDh) – USB Pipe Configuration
143 AT85C51SND3Bx7632A–MP3–03/06Reset Value = 0000 0000bTable 145. UPSTAX RegisterUPSTAX (1.CEh) – USB Pipe Status Register7 6 5 4 3 2 1 0CFGOK OVER
144AT85C51SND3Bx 7632A–MP3–03/06Reset Value = 0000 0000bReset Value = 0000 0000bTable 146. UPINRQX RegisterUPINRQX (1.DFh) – USB Pipe IN Number Of R
145 AT85C51SND3Bx7632A–MP3–03/06Table 148. UPINTX RegisterUPINTX (1.C8h) – USB Pipe Interrupt Register7 6 5 4 3 2 1 0FIFOCON NAKEDI RWAL PERRI TXSTP
146AT85C51SND3Bx 7632A–MP3–03/06Reset Value = 0000 0000bReset Value = 0000 0000b0 RXINIIN Data receivedSet by hardware when a new USB message is stor
147 AT85C51SND3Bx7632A–MP3–03/06Reset Value = 0000 0000bReset Value = 0000 0000bReset Value = 0000 0000bBit NumberBit MnemonicDescription7-0 PDAT7:0P
148AT85C51SND3Bx 7632A–MP3–03/06Reset Value = 0000 0000bTable 153. UPINT RegisterUPINT (1.D6h) – USB Pipe IN Number Of Request Register7 6 5 4 3 2 1
149 AT85C51SND3Bx7632A–MP3–03/06Audio Controller The Audio Controller embedded in AT85C51SND3Bx is based on four functional blocks detailed in the fo
15 AT85C51SND3Bx7632A–MP3–03/06Internal Pin Structure Table 17. Detailed Internal Pin StructureCircuit(1)Type PinsInput/Output RSTInput/OutputP0.7:0
150AT85C51SND3Bx 7632A–MP3–03/06Figure 71. Audio Processor Block DiagramAudio Buffer The audio buffer receives the audio data flow coming from DFC o
151 AT85C51SND3Bx7632A–MP3–03/06In order to avoid any spurious interrupts on the CPU side when a data transfer with the data flow controller is estab
152AT85C51SND3Bx 7632A–MP3–03/06Digital Volume Control The digital volume is controlled separately on right and left channel by setting the DVR4:0 an
153 AT85C51SND3Bx7632A–MP3–03/06Mixing Mode A mixing mode can be established by setting MIXEN bit in AUCON. It consists in mixing the ADC output comi
154AT85C51SND3Bx 7632A–MP3–03/06Audio Codec The audio codec is controlled by four registers as detailed in Figure 74: Figure 74. Audio Codec Block D
155 AT85C51SND3Bx7632A–MP3–03/06Table 157. Audio Codec Output GainOutput Drive Control Output buffers can operate in two modes depending on the powe
156AT85C51SND3Bx 7632A–MP3–03/06Line Inputs Preamplifier Gain In AT85C51SND3B2 & AT85C51SND3B3, when Line Inputs are selected as output source (e
157 AT85C51SND3Bx7632A–MP3–03/06Figure 75. Audio DAC Interface Block DiagramClock Controller As soon as audio DAC interface is enabled by setting AD
158AT85C51SND3Bx 7632A–MP3–03/06Figure 77. Audio Output FormatRegistersDSELDCLKDDATMSBI2S Format with DSIZE = 0 and JUST4:0 = 00001.LSB B14 MSBLSB B
159 AT85C51SND3Bx7632A–MP3–03/06Reset Value = 0000 0000bReset Value = 0000 0000b2-1 -ReservedThe value read from these bits is always 0. Do not set t
16AT85C51SND3Bx 7632A–MP3–03/06OutputSDCLKSCKNFCE3:0NFCLENFALENFWENFRENFWPSMCEDSELDDATDCLKOCLKLWR/LELA0/LRSLRD/LRWLCSUVCONTXDInput/OutputDPFDMFInput/
160AT85C51SND3Bx 7632A–MP3–03/06Reset Value = 0000 0000bReset Value = 0000 0000bReset Value = 0000 0000b1 APLOADAudio Processor Load Enable BitSet to
161 AT85C51SND3Bx7632A–MP3–03/06Reset Value = 0000 0000bReset Value = 0000 0000bReset Value = 0000 0000bTable 170. APIEN RegisterAPIEN (1.E9h) – Aud
162AT85C51SND3Bx 7632A–MP3–03/06Reset Value = 0000 0000bReset Value = 0000 0000bTable 173. APTIM2 RegisterAPTIM2 (2.C9h) – Audio Processor Timer Reg
163 AT85C51SND3Bx7632A–MP3–03/06Reset Value = 0000 0000bTable 176. APELEV Register APELEV (2.F7h) - Audio Processor Equalizer Level Status Register7
164AT85C51SND3Bx 7632A–MP3–03/06Reset Value = 0000 0000bReset Value = 0000 0000bReset Value = 0000 0000b0AOEN-AT85C51SND3B2 and AT85C51SND3B3: Audio
165 AT85C51SND3Bx7632A–MP3–03/06Reset Value = 0000 0000bReset Value = 0000 0000bTable 180. ACOLG Register (AT85C51SND3B2 and AT85C51SND3B3 only)ACOL
166AT85C51SND3Bx 7632A–MP3–03/06Reset Value = 0000 0000bReset Value = 0000 1000bReset Value = 0000 0000bReset Value = 0000 0000b1-2 OVERS1:0Audio Ove
167 AT85C51SND3Bx7632A–MP3–03/06Reset Value = 0000 0000bReset Value = 0000 0000bTable 186. ASSTA1 RegisterASSTA1 (2.E3h) – Audio Stream Status Regis
168AT85C51SND3Bx 7632A–MP3–03/06Nand Flash ControllerThe AT85C51SND3Bx implement a hardware Nand Flash Controller (NFC) embedding the following featu
169 AT85C51SND3Bx7632A–MP3–03/06Figure 79. Nand Flash ConnectionClock Unit The NFC clock is generated based on the clock generator as detailed in Se
17 AT85C51SND3Bx7632A–MP3–03/06Notes: 1. For information on resistor value, input/output levels, and drive capability, refer to Section “DC Character
170AT85C51SND3Bx 7632A–MP3–03/06Reset Value = 0000 0000bReset Value = 0001 1110bTable 189. NFPGCFG / SMPGCFG RegistersNFPGCFG / SMPGCFG – NF / SMC D
171 AT85C51SND3Bx7632A–MP3–03/06Reset Value = 0000 0000bSpecific Action As soon as the NFC is configured, the NFC is ‘idle’, i.e. ready for operation
172AT85C51SND3Bx 7632A–MP3–03/06Table 193. Device Selection Allowed Configuration“Read” Session A “read” session is launched and the DFC flow contro
173 AT85C51SND3Bx7632A–MP3–03/06Note that it is not possible to reset A9:8 after each command (write in NFCMD): the device status read command is use
174AT85C51SND3Bx 7632A–MP3–03/06Data Reading/Writing The NFDAT and NFDATF registers allow reading or writing of a byte without the use of the DFC as
175 AT85C51SND3Bx7632A–MP3–03/06Assembly code: mov #, direct• A read of NFDAT returns to the CPU the byte contained in that register, but does not la
176AT85C51SND3Bx 7632A–MP3–03/06Figure 80. Nand Flash Read ExampleLegend:•“ifc CPU” illustrates the commands given by the CPU to the NFC.• “auto” il
177 AT85C51SND3Bx7632A–MP3–03/06Table 195. Spare Zone ContentThe bytes which are not managed by the NFC are written to FFh.Write Session The spare z
178AT85C51SND3Bx 7632A–MP3–03/06Spare Zone Mode 1 The spare zone is not managed by the NFC. The data zone is contiguous.The user sends the commands t
179 AT85C51SND3Bx7632A–MP3–03/06• read the ECC FIFO, (keeping the ECCs in memory), re-initialize it, resume the data transfer, and to write all the E
18AT85C51SND3Bx 7632A–MP3–03/06Power Management The Power Management implements all the internal power circuitry (regulators, links…) as well as powe
180AT85C51SND3Bx 7632A–MP3–03/06Write Protection The NFC provides a hardware mechanism to protect full or part of the memory against any spurious wri
181 AT85C51SND3Bx7632A–MP3–03/06Figure 81. Nand Flash Write Protection SchemeSince the NFWP signal state is part of the device status, the user can
182AT85C51SND3Bx 7632A–MP3–03/06Card UnitEnable Smartmedia or XD card management is enabled by setting SMCEN bit in SCFG1 regis-ter as detailed in Se
183 AT85C51SND3Bx7632A–MP3–03/06Card Lock Input As shown in Figure 83 the SMLCK (SMC/XD Lock) input implements an internal pull-up, in order to provi
184AT85C51SND3Bx 7632A–MP3–03/06• or illegal operation (ILGLI)– Attempt to access a NF device which is not declared (e.g. DEV= 4 while NUMDEV= 2)– Wr
185 AT85C51SND3Bx7632A–MP3–03/06Reset Value = 0000 0000bReset Value = 0000 0000bTable 204. NFCON RegisterNFCON (1.9Bh) – Nand Flash Controller Contr
186AT85C51SND3Bx 7632A–MP3–03/06Reset Value = 0000 0000bA read of that register returns an unexpected value.Reset Value = 0000 0000bReset Value = 000
187 AT85C51SND3Bx7632A–MP3–03/06Reset Value = 0000 0000bReset Value = 0000 0000bTable 210. NFDAT RegisterNFDAT (1.A2h) – Nand-Flash Controller Data
188AT85C51SND3Bx 7632A–MP3–03/06Reset Value = 0000 0000bReset Value = 0000 0000bReset Value = 0000 0000b0 NFRUNRunning FlagSet by hardware to signal
189 AT85C51SND3Bx7632A–MP3–03/06Reset Value = 0000 0000bReset Value = 0000 0000bTable 215. NFIEN RegisterNFIEN (1.A6h) – Nand Flash Controller Inter
19 AT85C51SND3Bx7632A–MP3–03/06Schematic Figure 6. Regulator ConnectionNote: Depending on power supply scheme, CLV may replace CDC capacitor (see Fi
190AT85C51SND3Bx 7632A–MP3–03/06Reset Value = 0000 0000bReset Value = 0000 0000bTable 217. NFBPH RegisterNFUDAT (1.94h) – Nand Flash Controller Byte
191 AT85C51SND3Bx7632A–MP3–03/06MMC/SD Controller The AT85C51SND3Bx embed a MMC/SD controller allowing connecting of MMC and SD cards in 1-bit or 4-b
192AT85C51SND3Bx 7632A–MP3–03/06tion from the card through the SDCMD line. These channels are detailed in the following sections.Figure 87. Command
193 AT85C51SND3Bx7632A–MP3–03/06Figure 88. Command Transmission FlowCommand Receiver The end of the response reception is signalled by the EORI flag
194AT85C51SND3Bx 7632A–MP3–03/06Data Line Controller As shown in Figure 89, the data line controller is based on a 16-Byte FIFO used both by the data
195 AT85C51SND3Bx7632A–MP3–03/06Data Configuration Before sending or receiving any data, the data line controller must be configured accord-ing to th
196AT85C51SND3Bx 7632A–MP3–03/06Data Transmission Transmission is enabled by setting DATEN bit in MMCON1 register. FIFO must be filled after this fla
197 AT85C51SND3Bx7632A–MP3–03/06Figure 91. Data Stream Transmission FlowsSendSTOP CommandData Stream TransmissionFIFO Fillingwrite 16 data to MMDATF
198AT85C51SND3Bx 7632A–MP3–03/06Figure 92. Data Block Transmission FlowsData ReceiverConfiguration To receive data from the card the data controller
199 AT85C51SND3Bx7632A–MP3–03/06from such situation. In case of time-out, the data controller and its internal state machine may be reset by setting
2AT85C51SND3Bx 7632A–MP3–03/06• Packages– LQFP100, BGA100, DiceNotes: 1. See Ordering Information2. Future product3. AT85C51SND3B2 & AT85C51SND3B
20AT85C51SND3Bx 7632A–MP3–03/06Battery Voltage Monitor The battery voltage monitor is a 5-bit / 50 mV resolution A to D converter with fixed con-vers
200AT85C51SND3Bx 7632A–MP3–03/06Figure 94. Data Block Reception FlowsCard ManagementCard Detect Input As shown in Figure 95 the SDINS (MMC/SD Card D
201 AT85C51SND3Bx7632A–MP3–03/06Figure 96. SD Card Write Protection Input Block DiagramInterrupt As shown in Figure 97, the MMC controller implement
202AT85C51SND3Bx 7632A–MP3–03/06RegistersReset Value = 0000 0010bTable 221. MMCON0 RegisterMMCON0 (1.B1h) – MMC Control Register 07 6 5 4 3 2 1 0- D
203 AT85C51SND3Bx7632A–MP3–03/06Reset Value = 0000 0000bReset Value = 0000 0000b2 DATENData Transfer Enable BitSet to enable data transmission or rec
204AT85C51SND3Bx 7632A–MP3–03/06Reset Value = 0000 0000bReset Value = XX00 0000b, depends wether a card is present in the socket or not and if it is
205 AT85C51SND3Bx7632A–MP3–03/06Reset Value = 0000 0000bTable 226. MMINT RegisterMMINT (1.BEh Read Only) – MMC Interrupt Register7 6 5 4 3 2 1 0CDET
206AT85C51SND3Bx 7632A–MP3–03/06Reset Value = 1111 1110bReset Value = 1111 1111bReset Value = 1111 1111b6 EORMEnd Of Response Interrupt Mask BitSet t
207 AT85C51SND3Bx7632A–MP3–03/06Parallel Slave InterfaceThe AT85C51SND3Bx implement a Parallel Slave Interface (PSI) allowing parallel con-nection wi
208AT85C51SND3Bx 7632A–MP3–03/06PSI Addressing The AT85C51SND3Bx are accessible by a host in read or write at two different address locations by sett
209 AT85C51SND3Bx7632A–MP3–03/06Figure 102. Write Data Sampling Configuration“SA0= H” Mode The “SA0= H” mode is particularly fitting control managem
21 AT85C51SND3Bx7632A–MP3–03/06Idle Mode Idle mode is a power reduction mode that reduces the power consumption. In this mode, program execution halt
210AT85C51SND3Bx 7632A–MP3–03/06Host can then read or write by burst an amount of data defined by the protocol (see Section “Data Flow Controller”, p
211 AT85C51SND3Bx7632A–MP3–03/06RegistersReset Value = 0000 0000bTable 231. PSICON RegisterPSICON (1.ADh) – PSI Control Register 7 6 5 4 3 2 1 0PSEN
212AT85C51SND3Bx 7632A–MP3–03/06Reset Value = 1000 0000bReset Value = 0000 0000bReset Value = 0000 0000b3-0 -ReservedThe value read from these bits i
213 AT85C51SND3Bx7632A–MP3–03/06Serial I/O PortThe AT85C51SND3Bx implement a Serial Input/Output Port (SIO) allowing serial com-munication. By using
214AT85C51SND3Bx 7632A–MP3–03/06Figure 106. SIO Block DiagramCharacter Format The character consists of five fields: start, data, parity, stop and g
215 AT85C51SND3Bx7632A–MP3–03/06Table 238. Stop Bit Number SelectionGuard Field The guard field is not part of a character and is an optional inter-
216AT85C51SND3Bx 7632A–MP3–03/06Figure 109. Baud Rate Generator Block DiagramTable 240. Baud Rate Generator Value (12x oversampling)Note: 1. This h
217 AT85C51SND3Bx7632A–MP3–03/06Receiver As shown in Figure 110, the receiver is based on a character handler taking care of character integrity chec
218AT85C51SND3Bx 7632A–MP3–03/06Receiver Errors There are three kinds of errors that can be set during character reception: the framing error, the pa
219 AT85C51SND3Bx7632A–MP3–03/06Figure 113. SIO Controller Interrupt SystemRegistersReset Value = 0000 0000bPEIESIEN.3TIESIEN.1SIOInterruptRISINT.0F
22AT85C51SND3Bx 7632A–MP3–03/06the clocks to the CPU and peripherals. Using INTn input, execution resumes when the input is released (see Figure 10)
220AT85C51SND3Bx 7632A–MP3–03/06Reset Value = 0000 0000bTable 243. SFCON RegisterSFCON (0.95h) – SIO Flow Control Register7 6 5 4 3 2 1 0OVRSF3 OVRS
221 AT85C51SND3Bx7632A–MP3–03/06Reset Value = 0X10 0010bReset Value = 0000 0000b1 TITransmission Interrupt FlagSet by hardware when the Tx FIFO is no
222AT85C51SND3Bx 7632A–MP3–03/06Reset Value = XXXX XXXXbReset Value = 0000 0000bReset Value = 0000 0000bReset Value = 0000 0000bTable 246. SBUF Regi
223 AT85C51SND3Bx7632A–MP3–03/06Serial Peripheral InterfaceThe AT85C51SND3Bx implement a Synchronous Peripheral Interface (SPI) allowing full-duplex,
224AT85C51SND3Bx 7632A–MP3–03/06Figure 115. Typical Slave SPI Bus ConfigurationDescription The SPI controller interfaces with the C51 core through t
225 AT85C51SND3Bx7632A–MP3–03/06The transmission begins by writing to SPDAT through CPU or DFC. Writing to SPDAT writes to an intermediate register w
226AT85C51SND3Bx 7632A–MP3–03/06When the AT85C51SND3Bx is the only slave on the bus, it can be useful not to use SSpin and get it back to I/O functio
227 AT85C51SND3Bx7632A–MP3–03/06Data Transfer The Clock Polarity bit (CPOL in SPCON) defines the default SCK line level in idle state(1) while the Cl
228AT85C51SND3Bx 7632A–MP3–03/06Figure 120 shows a SPI transmission with CPHA = 1, where the first SCK edge is used by the slave as a start of transm
229 AT85C51SND3Bx7632A–MP3–03/06– the MSTR bit in SPCON is clearedClearing the MODF bit is accomplished by reading SPSCR with MODF bit set, followed
23 AT85C51SND3Bx7632A–MP3–03/06Reset In order to secure the product functionality while in power-up or power-down phase or while in running phase, a
230AT85C51SND3Bx 7632A–MP3–03/06OverRun Condition This error means that the speed is not adapted for the running application. An OverRun condition oc
231 AT85C51SND3Bx7632A–MP3–03/06Reset Value = 0001 0100b4 MSTRMaster Mode SelectSet to select the master mode. Clear to select the slave mode.3 CPOLS
232AT85C51SND3Bx 7632A–MP3–03/06Reset Value = 0000 1000bReset Value = XXXX XXXXb1 SPTEIESPTE Interrupt Enable BitSet to enable SPTE interrupt generat
233 AT85C51SND3Bx7632A–MP3–03/06Display Interface The AT85C51SND3Bx implement a display interface allowing glueless direct interfacing (thanks to its
234AT85C51SND3Bx 7632A–MP3–03/06Access Cycles The AT85C51SND3Bx enables connection of LCD controller with normalized 6800 and 8080 interface as shown
235 AT85C51SND3Bx7632A–MP3–03/06Sleep Wait Time The sleep wait time is the time between two consecutive access cycle. It can be pro-grammed by SLW1:0
236AT85C51SND3Bx 7632A–MP3–03/06RegistersReset Value= 0000 0000bTable 255. LCDCON0 RegisterLCDCON0 (1.96h) – LCD Control Register 07 6 5 4 3 2 1 0BU
237 AT85C51SND3Bx7632A–MP3–03/06Reset Value= 0000 0000bReset Value= 0000 0000bReset Value= 0000 0000b3 LCYCTCycle Type SelectionSet to select non nor
238AT85C51SND3Bx 7632A–MP3–03/06Reset Value= 0000 0000bTable 259. LCDDAT RegisterLCDDAT (1.97h) – LCD Data Register7 6 5 4 3 2 1 0LD7 LD6 LD5 LD4 LD
239 AT85C51SND3Bx7632A–MP3–03/06Keyboard Interface The AT85C51SND3Bx implement a keyboard interface allowing the connection of a 4 x n matrix keyboar
24AT85C51SND3Bx 7632A–MP3–03/06Figure 13. Reset Circuitry and Power-On ResetCold Reset 2 conditions are required before enabling a CPU start-up:•VDD
240AT85C51SND3Bx 7632A–MP3–03/06Registers Table 260. KBCON RegisterKBCON (0.A3h) – Keyboard Control RegisterReset Value = 0000 1111bTable 261. KBST
4AT85C51SND3Bx 7632A–MP3–03/06Electrical CharacteristicsAbsolute Maximum RatingDC CharacteristicsDigital Logic Table 257. Digital DC Characteristics
5 AT85C51SND3Bx7632A–MP3–03/06Oscillator & CrystalSchematic Figure 134. Crystal ConnectionNote: For operation with most standard crystals, no ex
6AT85C51SND3Bx 7632A–MP3–03/06Parameters Table 259. DC-DC Filter CharacteristicsTA = -40 to +85°CTable 260. DC-DC Power CharacteristicsVBAT = 0.9 t
7 AT85C51SND3Bx7632A–MP3–03/06Table 263. Low Voltage Regulator Power CharacteristicsHVDD = 3 to 3.6 V; TA = -40 to +85°CUSBSchematic Figure 137. US
8AT85C51SND3Bx 7632A–MP3–03/06Parameters Table 265. Audio Codec Components CharacteristicsTA = -40 to +85°CNotes: 1. Value in low impedance mode (He
9 AT85C51SND3Bx7632A–MP3–03/06AC CharacteristicsNFC InterfaceDefinition of Symbols Table 1. NFC Interface Timing Symbol DefinitionsTimings Table 267
10AT85C51SND3Bx 7632A–MP3–03/06WaveformsFigure 140. NFC Command Latch Cycle WaveformsFigure 141. NFC Address Latch Cycle WaveformsFigure 142. NFC
11 AT85C51SND3Bx7632A–MP3–03/06Figure 143. NFC Write Cycle WaveformsMMC InterfaceDefinition of symbols Table 268. MMC Interface Timing Symbol Defin
12AT85C51SND3Bx 7632A–MP3–03/06Waveforms Figure 144. MMC Input-Output WaveformsLCD Interface To be definedDefinition of SymbolsTimingsWaveformsSIO I
25 AT85C51SND3Bx7632A–MP3–03/06RegistersReset Value = 00011 0000bTable 20. PCON RegisterPCON (0.87h) – Power Control Register7 6 5 4 3 2 1 0VBCEN VB
13 AT85C51SND3Bx7632A–MP3–03/06Table 271. SPI Interface Master AC TimingVDD = 1.65 to 3.6 V; TA = -40 to +85°CNote: 1. Value of this parameter depen
14AT85C51SND3Bx 7632A–MP3–03/06Waveforms Figure 145. SPI Slave Waveforms (SSCPHA= 0)Note: 1. Not Defined but generally the MSB of the character whic
15 AT85C51SND3Bx7632A–MP3–03/06Figure 147. SPI Master Waveforms (SSCPHA= 0)Note: SS handled by software using general purpose port pin.Figure 148.
16AT85C51SND3Bx 7632A–MP3–03/06Audio DAC InterfaceDefinition of symbols Table 272. Audio DAC Interface Timing Symbol DefinitionsTimings Table 273.
17 AT85C51SND3Bx7632A–MP3–03/06Timings Table 275. External Clock AC TimingsVDD = 1.65 to 3.6 V; TA = -40 to +85°CWaveforms Figure 150. External Clo
253 AT85C51SND3Bx7632A–MP3–03/06Ordering InformationTable 280. Ordering InformationNotes: 1. Codec option, see Table 281 below.2. Contact sales offi
254AT85C51SND3Bx 7632A–MP3–03/06Package InformationLQFP 100
255 AT85C51SND3Bx7632A–MP3–03/06CTBGA 100
17632A–MP3–03/06AT85C51SND3A Table of ContentsFeatures ...
27632A–MP3–03/06AT85C51SND3A Registers...5
26AT85C51SND3Bx 7632A–MP3–03/06Reset Value = XX00 0XXXb(1)Note: 1. Reset value depends on the power supply presence and on the internal reset source.
37632A–MP3–03/06 AT85C51SND3APower-On and Reset ... 101Speed Ide
47632A–MP3–03/06AT85C51SND3A Clock Unit ... 169
57632A–MP3–03/06 AT85C51SND3AAC Characteristics...246Orderi
Printed on recycled paper.7632A–MP3–03/06© Atmel Corporation 2006. All rights reserved. Atmel®, logo and combinations thereof, are registered tradema
27 AT85C51SND3Bx7632A–MP3–03/06Clock Controller The AT85C51SND3Bx clock controller is based on an on-chip oscillator feeding two on-chip Phase Lock L
28AT85C51SND3Bx 7632A–MP3–03/06Figure 16. Crystal ConnectionClock Generator The clock generator provides the oscillator and higher frequency clocks
29 AT85C51SND3Bx7632A–MP3–03/06Figure 18. PLL Block Diagram and SymbolTable 24. PLL Reverse Clock SelectionPLL Programming The PLL is programmed de
3 AT85C51SND3Bx7632A–MP3–03/06Block DiagramFigure 1. AT85C51SND3Bx Block DiagramNotes: 1. AT85C51SND3B3 only2. AT85C51SND3B2 & AT85C51SND3B3 onl
30AT85C51SND3Bx 7632A–MP3–03/06Figure 19. System Clock Generator Block Diagram and SymbolsTable 26. System Clock SelectionX2 Feature Unlike standar
31 AT85C51SND3Bx7632A–MP3–03/06Figure 21. DFC/NFC Clock Generator Block Diagram and SymbolTable 27. DFC/NFC Clock SelectionMMC Clock Generator The
32AT85C51SND3Bx 7632A–MP3–03/06Table 28. MMC Clock SelectionTable 29. MMC Clock DividerSIO Clock Generator As detailed in Figure 23, the SIO clock
33 AT85C51SND3Bx7632A–MP3–03/06RegistersReset Value = 0000 0000bTable 31. CKCON RegisterCKCON (0.8Fh) – Clock Control Register7 6 5 4 3 2 1 0- WDX2
34AT85C51SND3Bx 7632A–MP3–03/06Reset Value = 0000 0000bTable 32. CKEN RegisterCKEN (0.B9h) – Clock Enable Register7 6 5 4 3 2 1 0CKGENE PLLEN - PLOC
35 AT85C51SND3Bx7632A–MP3–03/06Reset Value = 0000 0000bReset Value = 0000 0000bReset Value = 0000 0000bTable 33. CKSEL RegisterCKSEL (0.BAh) – Clock
36AT85C51SND3Bx 7632A–MP3–03/06Special Function RegistersSFR Pagination The AT85C51SND3Bx implement a SFR pagination mechanism which allows mapping o
37 AT85C51SND3Bx7632A–MP3–03/06SFR Registers The Special Function Registers (SFRs) of the AT85C51SND3Bx fall into the categories detailed in Table 39
38AT85C51SND3Bx 7632A–MP3–03/06Table 42. Interrupt SFRs Mnemonic Add Name 7 6 5 4 3 2 1 0IEN0 0.A8h Interrupt Enable Control 0 EA EAUP EDFC ES ET1 E
39 AT85C51SND3Bx7632A–MP3–03/06Table 46. Memory Management SFRsMnemonic Add Name 7 6 5 4 3 2 1 0MEMCBAX 0.F2h Memory CODE Base Address CBAX16:9MEMDB
4AT85C51SND3Bx 7632A–MP3–03/06Application InformationThe AT85C51SND3Bx allow design of 2 typical applications which differentiate by the power supply
40AT85C51SND3Bx 7632A–MP3–03/06USB Device Registers (HOST cleared)UDCON 1.D9h Device Global Control - - - - - - RMWKUP DETACHUDINT 1.D8hDevice Global
41 AT85C51SND3Bx7632A–MP3–03/06USB Pipe Registers (HOST set)UPNUM 1.C9h USB Host Pipe Number - - - - - PNUM2:0UPRST 1.CAh USB Host Pipe Reset - PRST6
42AT85C51SND3Bx 7632A–MP3–03/06NFBPH 1.94h NF Byte Position (MSB) BP15:8NFBPL 1.95h NF Byte Position (LSB) BP7:0Table 50. NFC SFRsMnemonicAddName 7
43 AT85C51SND3Bx7632A–MP3–03/06Note: Available in AT85C51SND3B2 & AT85C51SND3B3 only.APEBS 2.F6hAudio Processor Equalizer Band Select- - - - 0 EQ
44AT85C51SND3Bx 7632A–MP3–03/06SINT 1.A8h SIO Interrupt - - EOTI OEI PEI FEI TI RISIEN 1.A9h SIO Interrupt Enable - - EOTIE OEIE PEIE FEIE TIE RIESBU
45 AT85C51SND3Bx7632A–MP3–03/06Notes: 1. SFR registers with least significant nibble address equal to 0 or 8 are bit-addressable.Table 59. SFR Page
46AT85C51SND3Bx 7632A–MP3–03/06Note: 1. SFR registers with least significant nibble address equal to 0 or 8 are bit-addressable.Table 60. SFR Page 1
47 AT85C51SND3Bx7632A–MP3–03/06Notes: 1. SFR registers with least significant nibble address equal to 0 or 8 are bit-addressable.2. Available in AT85
48AT85C51SND3Bx 7632A–MP3–03/06Notes: 1. SFR registers with least significant nibble address equal to 0 or 8 are bit-addressable.2. SVERS reset value
49 AT85C51SND3Bx7632A–MP3–03/06Memory Space The AT85C51SND3Bx provide an “all in one” 64K bytes of RAM split between the three standard C51 memory se
5 AT85C51SND3Bx7632A–MP3–03/06Low Voltage 3V SystemFigure 3. Typical Low Voltage 3V Application3V NF MemoriesSD/MMC3V DC-DCBatteryFM ModuleAT85C51SN
50AT85C51SND3Bx 7632A–MP3–03/06Table 63. Register Bank SelectionThe next 16 Bytes above the register banks form a block of bit-addressable memory sp
51 AT85C51SND3Bx7632A–MP3–03/06The Figure 27 shows the memory segments configuration after bootstrap execution along with an example of user memory s
52AT85C51SND3Bx 7632A–MP3–03/06Reset Value MEMCBA0 = 0 0000 000bReset Value MEMDBAX = 0 1111 111bReset Value MEMXBAX = 0 1111 000bTable 65. MEMCBAX
53 AT85C51SND3Bx7632A–MP3–03/06Reset Value MEMCSX = 1110 1111bReset Value MEMXSX = 0000 1110bBit NumberBit MnemonicDescription7-0 CSX7:0CODE Size Bit
54AT85C51SND3Bx 7632A–MP3–03/06
55 AT85C51SND3Bx7632A–MP3–03/06Interrupt System The AT85C51SND3Bx, like other control-oriented computer architectures, employ a program interrupt met
56AT85C51SND3Bx 7632A–MP3–03/06Table 71. Priority Within Same LevelInterrupt Name Priority NumberInterrupt Address VectorsInterrupt Request Flag Cle
57 AT85C51SND3Bx7632A–MP3–03/06Figure 28. Interrupt Control SystemEPSIIEN1.2EKBIEN1.1EMMCIEN1.5ESPIIEN1.3EX0IEN0.000011011EAIEN0.7EX1IEN0.2ET0IEN0.1
58AT85C51SND3Bx 7632A–MP3–03/06External InterruptsINT1:0 Inputs External interrupts INT0 and INT1 (INTn, n = 0 or 1) pins may each be programmed to b
59 AT85C51SND3Bx7632A–MP3–03/06RegistersReset Value = 0000 0000bTable 72. IEN0 RegisterIEN0 (0.A8h) – Interrupt Enable Register 07 6 5 4 3 2 1 0EA E
6AT85C51SND3Bx 7632A–MP3–03/06Pin DescriptionPinoutsFigure 4. AT85C51SND3Bx 100-pin QFP PackageNotes: 1. Leave these pins unconnected for AT85C51SND
60AT85C51SND3Bx 7632A–MP3–03/06Reset Value = 0000 0000bTable 73. IEN1 RegisterIEN1 (0.B1h) – Interrupt Enable Register 176543210- - EMMC ENFC ESPI E
61 AT85C51SND3Bx7632A–MP3–03/06Reset Value = X000 0000bTable 74. IPH0 RegisterIPH0 (0.B7h) – Interrupt Priority High Register 07 6 5 4 3 2 1 0- IPHA
62AT85C51SND3Bx 7632A–MP3–03/06Reset Value = 0000 0000bTable 75. IPH1 Register IPH1 (0.B3h) – Interrupt Priority High Register 17 6 5 4 3 2 1 0- - I
63 AT85C51SND3Bx7632A–MP3–03/06Reset Value = X000 0000bTable 76. IPL0 RegisterIPL0 (0.B8h) - Interrupt Priority Low Register 07 6 5 4 3 2 1 0- IPLAU
64AT85C51SND3Bx 7632A–MP3–03/06Reset Value = 0000 0000bTable 77. IPL1 RegisterIPL1 (0.B2h) – Interrupt Priority Low Register 17 6 5 4 3 2 1 0- - IPL
65 AT85C51SND3Bx7632A–MP3–03/06Timers/Counters The AT85C51SND3Bx implement 2 general-purpose, 16-bit Timers/Counters. They are identified as Timer 0
66AT85C51SND3Bx 7632A–MP3–03/06Figure 31. Timer 0 and Timer 1 Clock Controller and SymbolsTimer 0 Timer 0 functions as either a Timer or event Count
67 AT85C51SND3Bx7632A–MP3–03/06Figure 32. Timer/Counter x (x = 0 or 1) in Mode 0Figure 33. Mode 0 Overflow Period FormulaMode 1 (16-bit Timer) Mode
68AT85C51SND3Bx 7632A–MP3–03/06Figure 36. Timer/Counter x (x = 0 or 1) in Mode 2Figure 37. Mode 2 Auto-reload Period FormulaMode 3 (2 x 8-bit Timer
69 AT85C51SND3Bx7632A–MP3–03/06Timer 0 Enhanced Mode Timer 0 overflow period can be increased in all modes by enabling a divider as detailed in Figur
7 AT85C51SND3Bx7632A–MP3–03/06Signals DescriptionSystem Table 1. System Signal DescriptionTable 2. Ports Signal DescriptionSignal NameType Descript
70AT85C51SND3Bx 7632A–MP3–03/06• It is important to stop the Timer/Counter before changing modes.Table 80. Timer/counter 1 Operating ModesMode 0 (13
71 AT85C51SND3Bx7632A–MP3–03/06RegistersReset Value = 0000 0000bTable 81. TCON RegisterTCON (0.88h) – Timer/Counter Control Register7 6 5 4 3 2 1 0T
72AT85C51SND3Bx 7632A–MP3–03/06Reset Value = 0000 0000bReset Value = 0000 0000bTable 82. TMOD RegisterTMOD (0.89h) – Timer/Counter Mode Control Regi
73 AT85C51SND3Bx7632A–MP3–03/06Reset Value = 0000 0000bReset Value = 0000 0000bReset Value = 0000 0000bTable 84. TL0 RegisterTL0 (0.8Ah) – Timer 0 L
74AT85C51SND3Bx 7632A–MP3–03/06Reset Value = 0000 0000bTable 87. SCHCLK RegisterSCHCLK (0.FEh) – Scheduler Clocks Register76543210- T0ETB2 T0ETB1 T0
75 AT85C51SND3Bx7632A–MP3–03/06Watchdog Timer The AT85C51SND3Bx implement a hardware Watchdog Timer (WDT) that automati-cally resets the chip if it i
76AT85C51SND3Bx 7632A–MP3–03/06Operation After reset, the WDT is disabled. The WDT is enabled by writing the sequence 1Eh and E1h into the WDTRST reg
77 AT85C51SND3Bx7632A–MP3–03/06RegistersReset Value = XXXX XXXXbReset Value = XXXX X000bTable 89. WDTRST RegisterWDTRST (0.A6h Write only) – Watchdo
78AT85C51SND3Bx 7632A–MP3–03/06Data Flow Controller The Data Flow Controller (DFC) embedded in the AT85C51SND3Bx is the multimedia data transfer mana
79 AT85C51SND3Bx7632A–MP3–03/06Table 92 shows the different peripherals (source or destination) ID number. These num-bers are used to program the SID
8AT85C51SND3Bx 7632A–MP3–03/06Table 3. Timer 0 and Timer 1 Signal DescriptionP4.6:0 I/OPort 4 P4 is a 7-bit bidirectional I/O port with internal pul
80AT85C51SND3Bx 7632A–MP3–03/06selected as source, the null device is always ready and sends the data (2 bytes) of the initialized CRC value MSB firs
81 AT85C51SND3Bx7632A–MP3–03/06Figure 46. Immediate Data Flow Abort DiagramFigure 47. Delayed Data Flow Abort DiagramData Flow Configuration Prior
82AT85C51SND3Bx 7632A–MP3–03/06RegistersReset Value = 0000 0000bTable 94. DFCON RegisterDFCON (1.89h) – DFC Control Register7 6 5 4 3 2 1 0- DFRES -
83 AT85C51SND3Bx7632A–MP3–03/06Reset Value = 0000 0000bReset Value = 0000 0000b3 DRDY0Channel 0 Destination Ready FlagSet by hardware when the source
84AT85C51SND3Bx 7632A–MP3–03/06Reset Value = 0000 0000bReset Value = 0000 0000bReset Value = 0000 0000bTable 97. DFD0 RegisterDFD0 (1.8Ah) – DFC Cha
85 AT85C51SND3Bx7632A–MP3–03/06USB Controller The AT85C51SND3Bx Implements a USB controller allowing the AT85C51SND3Bx to act as a USB device or a US
86AT85C51SND3Bx 7632A–MP3–03/06Figure 50. USB ConnectionGeneral Operating ModesIntroduction After a hardware reset, the USB controller is disabled.
87 AT85C51SND3Bx7632A–MP3–03/06• The DPACC bit and the DPADD10:0 field can be set by software. The DPRAM is not cleared.• The SPDCONF bits can be set
88AT85C51SND3Bx 7632A–MP3–03/06There are 2 kinds of interrupts: processing (i.e. their generation are part of the normal processing) and exception (e
89 AT85C51SND3Bx7632A–MP3–03/06Speed ControlDevice Mode When the USB interface is configured in device mode, the speed selection (Full Speed or High
9 AT85C51SND3Bx7632A–MP3–03/06Clock Controller Table 4. Clock Signal DescriptionMemory Controllers Table 5. Secure Digital Card / MutiMediaCard Con
90AT85C51SND3Bx 7632A–MP3–03/06When using this mode, there is no influence over the USB controller.Memory Management The controller only supports the
91 AT85C51SND3Bx7632A–MP3–03/06• First, Pipe/Endpoint 0 to Pipe/Endpoint 5 are configured, in the growing order. The memory of each is reserved in th
92AT85C51SND3Bx 7632A–MP3–03/06OTG Timers Customizing It is possible to refine some OTG timers thanks to the OTGTCON register (see Table 108). This r
93 AT85C51SND3Bx7632A–MP3–03/06The control logic of the UVCC pad outputs 2 signals:• The “session_valid” signal is active high when the voltage on th
94AT85C51SND3Bx 7632A–MP3–03/06ID Detection The ID pin transition is detected thanks to the following architecture:Figure 58. ID Detection Input Blo
95 AT85C51SND3Bx7632A–MP3–03/06Reset Value = 0010 0000bReset Value = 0000 0000bReset Value = 0000 0000b0 VBUSTEVBUS Transition Interrupt Enable BitSe
96AT85C51SND3Bx 7632A–MP3–03/06Reset Value = 0000 0000bReset Value = 0000 0000bTable 105. UDPADDH RegisterUDPADDH (1.E4h) – USB Dual Port Ram Direct
97 AT85C51SND3Bx7632A–MP3–03/06Reset Value = 0000 0000bReset Value = 0000 0000b5 HNPREQHNP Request BitSet to initiate the HNP when the controller is
98AT85C51SND3Bx 7632A–MP3–03/06Reset Value = 0000 0000bTable 109. OTGIEN RegisterOTGIEN (1.E7h) – USB OTG Interrupt Enable Register7 6 5 4 3 2 1 0-
99 AT85C51SND3Bx7632A–MP3–03/06Reset Value = 0000 0000b3 ROLEEXIRole Exchange Interrupt FlagSet by hardware when the USB controller has successfully
Commentaires sur ces manuels